LITHIUM.AjaxSupport.ComponentEvents.set({ }, "action" : "rerender" "event" : "ProductMessageEdit", "kudosable" : "true", "event" : "editProductMessage", } "eventActions" : [ { LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); "accessibility" : false, }, "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" "actions" : [ "event" : "ProductAnswerComment", { }, "actions" : [ ', 'ajax'); } "event" : "addThreadUserEmailSubscription", { { "context" : "", // If watching, pay attention to key presses, looking for right sequence. { { ] }); } "eventActions" : [ }, } }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'XVPfvbDKVUDSRPgKfq2CC-ibmYcJdea9ZzTOqu-4Y6g. "context" : "envParam:quiltName", ] } { ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2091665 .lia-rating-control-passive', '#form_4'); "event" : "MessagesWidgetEditCommentForm", } }, }, "action" : "pulsate" { { }, "quiltName" : "ForumMessage", "event" : "MessagesWidgetEditAnswerForm", { "event" : "deleteMessage", "selector" : "#kudosButtonV2_7", { { watching = true; "action" : "rerender" "selector" : "#messageview_7", "context" : "", $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { "actions" : [ "selector" : "#kudosButtonV2_8", { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "initiatorBinding" : true, "initiatorBinding" : true, "actions" : [ // console.log('watching: ' + key); } }, "event" : "approveMessage", "event" : "RevokeSolutionAction", LITHIUM.AjaxSupport.ComponentEvents.set({ { { "action" : "rerender" ] "event" : "removeMessageUserEmailSubscription", { "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); "event" : "ProductAnswerComment", { } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "linkDisabled" : "false" "actions" : [ ] "truncateBody" : "true", "event" : "ProductAnswer", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); "action" : "rerender" "actions" : [ "action" : "rerender" "context" : "", "action" : "rerender" "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); }); ] { { "context" : "lia-deleted-state", B. Dein Lieblingsrestaurant "revokeMode" : "true", "actions" : [ { "event" : "ProductAnswer", "event" : "QuickReply", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); "event" : "ProductAnswer", { }, "event" : "expandMessage", "action" : "rerender" { if ( neededkeys[count] == key ) { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); "action" : "rerender" "closeEvent" : "LITHIUM:lightboxCloseEvent", LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); "event" : "markAsSpamWithoutRedirect", "context" : "", "actions" : [ "context" : "", } { { $('#node-menu li.has-sub>a').on('click', function(){ var count = 0; "event" : "QuickReply", "action" : "rerender" ] "action" : "rerender" "actions" : [ "context" : "", { { $(this).toggleClass("view-btn-open view-btn-close"); { "actions" : [ "context" : "", "displaySubject" : "true", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); { { ;(function($) { function processPageInputBlur(pagerId, val) ] "useSimpleView" : "false", $('.lia-button-wrapper-searchForm-action').removeClass('active'); "disableKudosForAnonUser" : "false", "actions" : [ } // Reset the conditions so that someone can do it all again. "action" : "rerender" "actions" : [ }, LITHIUM.Dialog.options['1525265189'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; { LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "approveMessage", "disallowZeroCount" : "false", }, "actions" : [ }, ] }); "action" : "rerender" "useTruncatedSubject" : "true", { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2094929,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "eventActions" : [ "context" : "", }, "actions" : [ "initiatorBinding" : true, "action" : "rerender" { { }(LITHIUM.jQuery)); }, ;(function($) { LITHIUM.Dialog.options['662816016'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; .attr('aria-expanded','false') { "action" : "rerender" "action" : "pulsate" ] { }, "event" : "ProductAnswer", setWarning(pagerId); "actions" : [ "actions" : [ } } { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } ', 'ajax'); } "action" : "rerender" "linkDisabled" : "false" } ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); var count = 0; "event" : "addThreadUserEmailSubscription", } "action" : "rerender" }, "initiatorBinding" : true, "context" : "", "kudosable" : "true", }, { "context" : "", { { lithstudio: [], }, "entity" : "2091505", ;(function($) { ] { "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "MessagesWidgetMessageEdit", ] "showCountOnly" : "false", "useTruncatedSubject" : "true", ;(function($) { } "kudosLinksDisabled" : "false", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "expandMessage", "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" { setWarning(pagerId); "event" : "approveMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_38","feedbackSelector":".InfoMessage"}); "entity" : "1765136", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/7001/thread-id/95793","ajaxErrorEventName":"LITHIUM:ajaxError","token":"MQgqkyVvsPWCnzalVh_p3T841fhFywvJ04Fqd1JNeTM. "event" : "editProductMessage", }, "action" : "rerender" Execute whatever should happen when entering the right sequence "context" : "envParam:quiltName,product,contextId,contextUrl", { } "}); ] "actions" : [ "action" : "rerender" "actions" : [ "context" : "", "event" : "removeThreadUserEmailSubscription", "actions" : [ } "context" : "", "context" : "", ;(function($) { "showCountOnly" : "false", "initiatorDataMatcher" : "data-lia-message-uid" } { count = 0; "event" : "MessagesWidgetCommentForm", "closeEvent" : "LITHIUM:lightboxCloseEvent", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1763619,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "message" : "1765136", { "action" : "rerender" ] ] "context" : "lia-deleted-state", { "; if ( count == neededkeys.length ) { ] "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1765737 .lia-rating-control-passive', '#form_7'); { "context" : "", ] "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", } }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "event" : "deleteMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); { } ] "ajaxEvent" : "LITHIUM:lightboxRenderComponent", }, "actions" : [ "actions" : [ "disallowZeroCount" : "false", "action" : "rerender" }, "action" : "rerender" "event" : "unapproveMessage", "action" : "pulsate" watching = false; { "disableKudosForAnonUser" : "false", "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" "context" : "envParam:entity", }, .attr('aria-hidden','true') var neededkeys = [76, 79, 71, 77, 69, 73, 78]; } ;(function($) { "event" : "kudoEntity", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "expandMessage", } "event" : "ProductAnswerComment", } "event" : "expandMessage", "event" : "MessagesWidgetEditAnswerForm", "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", ] "context" : "", }, var keycodes = { { ] { LITHIUM.Dialog.options['-297176650'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "eventActions" : [ { "event" : "removeMessageUserEmailSubscription", { "context" : "", LITHIUM.Dialog.options['-321612786'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); "action" : "rerender" function processPageInputBlur(pagerId, val) "context" : "envParam:feedbackData", "useCountToKudo" : "false", "useTruncatedSubject" : "true", element.removeClass('active'); { { }, { "linkDisabled" : "false" "selector" : "#messageview_5", "actions" : [ "actions" : [ { { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1763582,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1765737 .lia-rating-control-passive', '#form_7'); "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "approveMessage", { "actions" : [ lithadmin: [] "actions" : [ "selector" : "#messageview_6", "}); } } event.stopPropagation(); "action" : "rerender" "action" : "rerender" { "event" : "deleteMessage", { "action" : "rerender" { } { ] }, ] "action" : "rerender" "event" : "editProductMessage", "event" : "MessagesWidgetMessageEdit", "actions" : [ "initiatorBinding" : true, function doChecks(pagerId, val) { { } ] { ] }, $(document).ready(function(){ "context" : "", { "messageViewOptions" : "1111110111111111111110111110100101001101" }, "context" : "envParam:selectedMessage", "disallowZeroCount" : "false", }, "context" : "", }, "context" : "envParam:selectedMessage", }); $(this).next().toggle(); LITHIUM.Dialog.options['1269272662'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] "action" : "pulsate" "initiatorBinding" : true, { "parameters" : { "action" : "rerender" })(LITHIUM.jQuery); { }, $(this).toggleClass("view-btn-open view-btn-close"); { resetMenu(); } "context" : "", "displayStyle" : "horizontal", ] "action" : "rerender" ], ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "event" : "RevokeSolutionAction", "context" : "", "parameters" : { "context" : "", { "context" : "", "actions" : [ ] { ] "action" : "rerender" } } { LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "envParam:quiltName,message", { { "context" : "envParam:feedbackData", ] }, { ] "event" : "approveMessage", "event" : "RevokeSolutionAction", { { "event" : "markAsSpamWithoutRedirect", "actions" : [ "event" : "QuickReply", { "action" : "rerender" "event" : "markAsSpamWithoutRedirect", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_35","feedbackSelector":".InfoMessage"}); "useSubjectIcons" : "true", "context" : "envParam:quiltName,message,product,contextId,contextUrl", watching = false; "actions" : [ "event" : "MessagesWidgetAnswerForm", { "context" : "", { ] LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "MessagesWidgetEditAction", { "event" : "addMessageUserEmailSubscription", "action" : "rerender" "selector" : "#kudosButtonV2_7", Selfservice-MeinVodafone-App-Quick-Check-Verbrauchsabfrage. }, "}); "parameters" : { ], ], "eventActions" : [ "showCountOnly" : "false", "revokeMode" : "true", } "actions" : [ "parameters" : { "context" : "", "action" : "pulsate" } { }, "actions" : [ } { "event" : "unapproveMessage", "actions" : [ "eventActions" : [ ] "actions" : [ $(document).ready(function(){ "displaySubject" : "true", }, "}); ] { } } "showCountOnly" : "false", "actions" : [ ] } } "context" : "envParam:quiltName", { { { var key = e.keyCode; { } "kudosLinksDisabled" : "false", "action" : "rerender" } }, }, } }, "context" : "", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); "actions" : [ { "useTruncatedSubject" : "true", if ( count == neededkeys.length ) { } }, ], { }, { }); "event" : "RevokeSolutionAction", }, { } { "eventActions" : [ "event" : "addThreadUserEmailSubscription", } "event" : "unapproveMessage", "action" : "rerender" } }, } { { "context" : "envParam:quiltName", } }, { "actions" : [ } } { "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" { o.innerHTML = ""; "context" : "", } "event" : "MessagesWidgetCommentForm", "context" : "lia-deleted-state", "forceSearchRequestParameterForBlurbBuilder" : "false", { ] { LITHIUM.AjaxSupport.ComponentEvents.set({ { { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "MessagesWidgetEditAction", { ] "action" : "pulsate" }, "eventActions" : [ "event" : "approveMessage", { { }, "event" : "unapproveMessage", Zur besseren Übersicht schieße ich hier den Thread. } }, LITHIUM.Auth.CHECK_SESSION_TOKEN = 'mQke-PeRFvF0hvWFqU71mVgamOBL8zBXYgGJS4qDmNs. "action" : "rerender" $(document).ready(function(){ }, }, "context" : "", }, "action" : "rerender" { } function processPageInputBlur(pagerId, val) "context" : "", { { return false; "useTruncatedSubject" : "true", "eventActions" : [ "event" : "MessagesWidgetEditCommentForm", }); }, "action" : "addClassName" LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "action" : "rerender" { "actions" : [ } { "context" : "lia-deleted-state", "actions" : [ "action" : "pulsate" "revokeMode" : "true", document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); }, "action" : "rerender" "context" : "", { element.siblings('li').removeClass('active'); { { "action" : "rerender" } "context" : "envParam:quiltName", } } "kudosable" : "true", ] ] "actions" : [ } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); }, "useCountToKudo" : "false", ] "disableLinks" : "false", } }, "actions" : [ "action" : "rerender" "action" : "rerender" { "context" : "", { { "event" : "MessagesWidgetAnswerForm", { "useSubjectIcons" : "true", LITHIUM.AjaxSupport.useTickets = false; lithstudio: [], } }, "action" : "rerender" }, {