Dieser findet sich für Verträge, die nach dem 8.3.2015 abgeschlossen wurden, in der Auftragsbestätigung. "parameters" : { "context" : "", ] "useSimpleView" : "false", "actions" : [ "action" : "rerender" ] "event" : "deleteMessage", }); } Ich habe mir überlegt eine AVM Fritzbox Cable zu holen (6490). "actions" : [ "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); // Set start to true only if the first key in the sequence is pressed "disableLabelLinks" : "false", "parameters" : { "event" : "ProductAnswerComment", return; { "event" : "MessagesWidgetAnswerForm", } ;(function($) { } "action" : "rerender" Hab so einen Router von CBN und ich würde gerne meine IPv4 ändern. "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ }, "actions" : [ "actions" : [ } }, ] Neue IP Adresse nach Router Neustart! { "context" : "", }, var clickHandler = function(event) { { "action" : "pulsate" } "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'rbezfimvXikNQlPjtWHFO5XXX8DQ5Oh8S_5cXnLId00. "context" : "", } "action" : "rerender" "event" : "approveMessage", }, "actions" : [ "useTruncatedSubject" : "true", { "context" : "", }, lithstudio: [], }); }, window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":479,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk12FlZbXURIfwhNVxAMUhAYdFFAQHVVHHNWFlI4GnpkRFEbB1JGCxReAUdWWm5KQgIUQj5NBlIMAgMAUBRKG1QQA1oBfFcWCFQEUg8LUlcBVQUGDR5HXQVsQQcQfgAXCRkDSRQNWmIDBVIqVF5REF8UIFZAFw9jC0VaV2IEUQMbHkAJVClaUV1eABRcG1QDDkQBFx8WWQZ0CU0QWEBRBVlAURBJFA1aZhpADUZTCwECBw8AAR8AUFZSGAcCC1cbBFsBVU9SVAYFAVMABlYJBFtAG0ZeUHpdAVMvXRBYQHYWVltdRC5\/NhseQAlUNlBAQGRXZxNcQBtADUZmdnh3JmJGUFZCJGUreBNZVxZFB15XEUJgLHBhcRIRWRZQUUwLU1kKE3h7KH8yGQ1AH0o="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "action" : "rerender" }, "context" : "", "closeEvent" : "LITHIUM:lightboxCloseEvent", { } { "context" : "", ] "initiatorBinding" : true, ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "action" : "rerender" { "event" : "unapproveMessage", "action" : "rerender" "componentId" : "kudos.widget.button", "Ich hab jetzt seine IP-Adresse. $(this).next().toggle(); "truncateBody" : "true", }, { LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "showCountOnly" : "false", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", Hallo ich bin bei Netcologne und habe den TP-Link Router : TL-WR841N und mein Router ist leider so einer bei dem sich die IP nur um 0:00 ändert also ich kann sie nicht mit einem neustart oder so ändern kennt ihr eine Methode wie ich die IP trotzdem ändern kann ich will keinen VPN! { "disableKudosForAnonUser" : "false", "action" : "rerender" "kudosLinksDisabled" : "false", { "useSimpleView" : "false", }); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1691725 .lia-rating-control-passive', '#form'); Handball: Was genau ist der President's Cup bei der WM? "actions" : [ LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_1ed96f8adfce50', 'enableAutoComplete', '#ajaxfeedback_1ed96f8adfce50_0', 'LITHIUM:ajaxError', {}, '1xYbcROzhhXdOPHc5ZUQiFdNq9baYFCP62odOsvvXyA. LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; })(LITHIUM.jQuery); "actions" : [ ] "action" : "rerender" "actions" : [ "context" : "envParam:quiltName", "context" : "", Bist du sicher, dass du fortfahren möchtest? { }, "action" : "rerender" }, }, Dort wird allen Kunden mit geeignetem Gerät automatisch eine IPv6-Adresse zur Verfügung gestellt. "triggerSelector" : ".lia-panel-dialog-trigger-event-click", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); ] "closeEvent" : "LITHIUM:lightboxCloseEvent", Nun meine Frage. { ] }, Nun habe ich seit Wochen das Problem das mein WLAN dauernd die Verbindung verliert und sich trennt....ich habe nichts verstellt und sitze genau daneben,über LAN Kabel funktioniert alles wunderbar. } ] "action" : "rerender" "event" : "addMessageUserEmailSubscription", "event" : "QuickReply", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "event" : "ProductAnswer", "event" : "ProductAnswer", { { "event" : "ProductMessageEdit", }, "context" : "", } Bist du sicher, dass du fortfahren möchtest? "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); "actions" : [ "actions" : [ "action" : "rerender" "entity" : "1691725", }, { "triggerEvent" : "LITHIUM:triggerDialogEvent", } "actions" : [ $(event.data.selector).addClass('cssmenu-open') }, "action" : "rerender" "event" : "editProductMessage", "actions" : [ } //$('#community-menu-toggle').removeClass('active') { { { ] Beim Strom abziehen ändert sich leider nichts, wegen Kabel Anschluss. :). { "context" : "", "quiltName" : "ForumMessage", .attr('aria-expanded','false') ] "context" : "", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1692772 .lia-rating-control-passive', '#form_1'); }, }); } "actions" : [ $('li.close-on-click').on('click',resetMenu); LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "", { $('section.header-announcement').slideUp(); "context" : "", "action" : "rerender" "actions" : [ { "showCountOnly" : "false", "event" : "MessagesWidgetEditAction", { "action" : "rerender" { $(document).ready(function(){ "dialogKey" : "dialogKey" "context" : "envParam:entity", "disableLinks" : "false", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:quiltName", ] { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1693906,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. } "action" : "pulsate" Kann ich meinen Kabel-Router im Bridge-Mode mit fester IP-Adresse nutzen und gleichzeitig WLAN aktivieren? ] } "action" : "rerender" } }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/75143","ajaxErrorEventName":"LITHIUM:ajaxError","token":"jlwlkHuN0J6I2kdZvx05Iw0gGEFdfwbfZiRjfTiFS9Y. $(document).keydown(function(e) { { { "event" : "MessagesWidgetCommentForm", "action" : "rerender" $(this).addClass('active') Ansonsten gibt es auf der Admin-Oberfläche des Routers bestimmt auch eine Möglichkeit, die IP zu erneuern. }, { { // If watching, pay attention to key presses, looking for right sequence. "forceSearchRequestParameterForBlurbBuilder" : "false", { element.siblings('li').find('li').removeClass('active'); "event" : "addMessageUserEmailSubscription", "context" : "envParam:quiltName", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); Kabel und DSL Internet, Telefon & TV: Erleb Highspeed Internet, günstige Telefonie und brilliantes HDTV. var cookieDomain = 'forum.vodafone.de'; LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); LITHIUM.Auth.CHECK_SESSION_TOKEN = 'u0D0OVNB60x9dTzIyY-BHpAdr93BmL0TxvS7QYWy_Zg. "actions" : [ "displaySubject" : "true", { ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_1ed96f8adfce50","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_1ed96f8adfce50_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/ArchivKIP/thread-id/75143&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"W5m3fJud9c2dZgSTerm9S1B5Ufbnp4nIkYmEgd98Pu4. { { ctaHTML += "Lösung noch nicht gefunden? } } "kudosLinksDisabled" : "false", }, "action" : "rerender" "context" : "", "action" : "pulsate" "selector" : "#messageview_2", "actions" : [ Bist du sicher, dass du fortfahren möchtest? ] "includeRepliesModerationState" : "false", if ( neededkeys[count] == key ) { })(LITHIUM.jQuery); }, if ( watching ) { { "}); "messageViewOptions" : "1111110111111111111110111110100101001101" $(document).ready(function(){ "context" : "envParam:entity", } { { Hab so einen Router von CBN und ich würde gerne meine IPv4 ändern. { } { LITHIUM.Dialog.options['537737561'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } "event" : "AcceptSolutionAction", }); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); "action" : "rerender" "componentId" : "forums.widget.message-view", "event" : "removeThreadUserEmailSubscription", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1692772,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "approveMessage", ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1692772 .lia-rating-control-passive', '#form_1'); { { "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" // If watching, pay attention to key presses, looking for right sequence. } "action" : "rerender" "context" : "envParam:quiltName", //$(window).scroll(function() { return; "action" : "rerender" "}); "event" : "removeMessageUserEmailSubscription", "event" : "ProductAnswer", "context" : "lia-deleted-state", "action" : "rerender" })(LITHIUM.jQuery); "accessibility" : false, element.siblings('li').children('ul').slideUp(); "context" : "lia-deleted-state", "}); "event" : "MessagesWidgetCommentForm", expireDate.setDate(expireDate.getDate() + 365*10); }); "event" : "MessagesWidgetCommentForm", LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] "disableKudosForAnonUser" : "false", "action" : "rerender" "context" : "", "actions" : [ ] // We made it! ] "event" : "removeThreadUserEmailSubscription", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "MessagesWidgetAnswerForm", { "event" : "MessagesWidgetMessageEdit", { { LITHIUM.Dialog.options['553595914'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; }, "actions" : [ { "action" : "rerender" "disableLabelLinks" : "false", count = 0; }, } LITHIUM.Dialog.options['537737561'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "", "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "ajaxEvent" : "LITHIUM:lightboxRenderComponent", { "action" : "rerender" "disableLinks" : "false", ] { "event" : "ProductAnswerComment", } ] "}); { }); }, PS : Wenn ich die MAC Adresse ändere habe ich kein Internet. }, "initiatorDataMatcher" : "data-lia-message-uid" "event" : "ProductAnswer", "event" : "RevokeSolutionAction", ', 'ajax'); { }, Hast Du den Router auch schon mal etwas länger vom Strom getrennt? ] } "context" : "envParam:quiltName", }, Kabel deutschland sagt es liegt daran, dass die am Netz Ausbau sind (...dann würde es wohl auch über LAN Kabel Abbrüche geben, aber darauf sind die nichtmal eingegangen). "event" : "MessagesWidgetEditAnswerForm", "context" : "envParam:quiltName", "event" : "deleteMessage", "actions" : [ "context" : "envParam:quiltName", { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "context" : "", "parameters" : { "actions" : [ { return; } "actions" : [ "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", watching = false; $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); "disableLabelLinks" : "false", "action" : "pulsate" { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); "context" : "", }, "context" : "envParam:quiltName", $(this).next().toggle(); "action" : "addClassName" "actions" : [ "context" : "", }); return; } "actions" : [ "actions" : [ { "parameters" : { "actions" : [ { ] { }, } "context" : "", { var key = e.keyCode; } ] { "disallowZeroCount" : "false", { } "event" : "MessagesWidgetAnswerForm", Jedoch ist das WLAN sehr langsam und beim Download mit LAN -Kabel habe ich nur 2 MBit/s pro Sekunde. "event" : "kudoEntity", watching = false; ;(function($){ "useSubjectIcons" : "true", "entity" : "1693906", // We made it! ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }); "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "actions" : [ "disableLabelLinks" : "false", return; "revokeMode" : "true", $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); "action" : "rerender" "showCountOnly" : "false", Vodafone einigt sich mit den Kabel-Deutschland-Aktionären auf einen weiteren Ankauf von Aktienpaketen und würde am Ende 93,8 Prozent der Aktien halten. "initiatorDataMatcher" : "data-lia-message-uid" { "action" : "pulsate" }, ], ] "event" : "approveMessage", "event" : "MessagesWidgetCommentForm", "event" : "MessagesWidgetMessageEdit", } "action" : "rerender" LITHIUM.Dialog({ ] { "context" : "", "actions" : [ "action" : "rerender" "actions" : [ "useTruncatedSubject" : "true", })(LITHIUM.jQuery); { "action" : "rerender" "action" : "rerender" "action" : "rerender" ] "action" : "rerender" "event" : "MessagesWidgetAnswerForm", count = 0; "event" : "approveMessage", }, { ', 'ajax'); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, { "event" : "QuickReply", })(LITHIUM.jQuery); ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_1ed96f8adfce50_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/ArchivKIP/thread-id/75143&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { "displaySubject" : "true", "action" : "rerender" "actions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "", } { { } "event" : "ProductAnswerComment", { ] resetMenu(); { "selector" : "#messageview_2", } }, Kann es sein, dass der gute Mann bei seinen Arbeiten irgendwelche Einstellungen vorgenommen hat, die mir des verbieten? Bist du sicher, dass du fortfahren möchtest? LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/ArchivKIP/thread-id/75143","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Wg8wqNSBVBJz2OmDa90iJiTUDuwCNahwbNST7ewxBow. }); { "action" : "pulsate" } "action" : "rerender" "parameters" : { LITHIUM.AjaxSupport.useTickets = false; "event" : "AcceptSolutionAction", { "useSimpleView" : "false", "eventActions" : [ ] "context" : "envParam:feedbackData", "event" : "MessagesWidgetEditCommentForm", "event" : "unapproveMessage", ] Ich find keinen anbieter bei dem ich den selben Preis für die selbe Leistung bekomme, alles teurer :/. ] "useCountToKudo" : "false", ] $('#node-menu li.has-sub>a').on('click', function(){ } "event" : "unapproveMessage", LITHIUM.Dialog({ "context" : "", ] } if ( watching ) { ], Behoben Eisleben: Einschränkung der Festnetz-Telefonie, Behoben Oscherlseben: Einschränkung der Mobilen Telefonie und Daten, MeinVodafone-App/-Web:  Automatisches Logout beim Aufrufen von "Mein Tarif", Selfservice-MeinVodafone-App-Quick-Check-Verbrauchsabfrage der automatische Login über W-Lan funktioniert nicht, Nähere Informationen dazu findet Ihr im Eilmeldungsboard. "action" : "rerender" } }, "includeRepliesModerationState" : "false", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "MessagesWidgetAnswerForm", } "includeRepliesModerationState" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#pageInformation","feedbackSelector":".InfoMessage"}); $(document).keydown(function(e) { "event" : "markAsSpamWithoutRedirect", LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'rbezfimvXikNQlPjtWHFO5XXX8DQ5Oh8S_5cXnLId00. "eventActions" : [ "actions" : [ }, "action" : "rerender" } LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_1ed96f8adfce50","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/ArchivKIP/thread-id/75143&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); } "context" : "envParam:feedbackData", "event" : "ProductMessageEdit", "event" : "expandMessage", var keycodes = { Execute whatever should happen when entering the right sequence LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); } "actions" : [ ] "actions" : [ "action" : "rerender" "kudosable" : "true", { "context" : "envParam:quiltName,expandedQuiltName", "disableLinks" : "false", } } setCookie: function(cookieName, cookieValue) { } } "action" : "rerender" count = 0; ] "event" : "AcceptSolutionAction", // We made it! ', 'ajax'); "kudosable" : "true", "entity" : "1692772", "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ { }, "event" : "removeThreadUserEmailSubscription", "truncateBody" : "true", "showCountOnly" : "false", "action" : "rerender" ], $('li.close-on-click').on('click',resetMenu); }, "context" : "envParam:feedbackData", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, ] ] LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'irf72x5VxY8PwjW7gwez413aOsNvX_FKFxdG8JsBWC8. } "action" : "rerender" LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_1ed96f8adfce50","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); "actions" : [ "event" : "addMessageUserEmailSubscription", ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "useCountToKudo" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); ] "componentId" : "forums.widget.message-view", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); })(LITHIUM.jQuery); }, "action" : "rerender" { document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); "actions" : [ "context" : "", "actions" : [ "action" : "pulsate" Bitte erstellt einen Thread, wenn Ihr Hilfe benötigt. "actions" : [ LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); "action" : "rerender" { ] "initiatorBinding" : true, { "actions" : [ ] ', 'ajax'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); "kudosable" : "true", lithstudio: [], } { "showCountOnly" : "false", ] LITHIUM.AjaxSupport.ComponentEvents.set({ { }, "context" : "envParam:quiltName,message,product,contextId,contextUrl",