"action" : "rerender" Execute whatever should happen when entering the right sequence { } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); } Bei Vodafone gibt es den 50mbit Tarif für 29euro und 100mbit für 34euro. }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", } ] { { "actions" : [ "action" : "rerender" "componentId" : "kudos.widget.button", Die Anklopfen-Funktion ist bei Ihrem Anschluss standardmäßig immer eingeschaltet. ] "actions" : [ "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", { }, "actions" : [ $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2089845,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101011101" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); Execute whatever should happen when entering the right sequence { } ] } { "triggerEvent" : "click", LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'O0zKaqZODTgAIIQwI5vUBjwxOOCHc8Yb_D2hw-UDUG8. "actions" : [ "eventActions" : [ { "action" : "rerender" "quiltName" : "ForumMessage", { // console.log('watching: ' + key); lithstudio: [], "accessibility" : false, "event" : "RevokeSolutionAction", "truncateBodyRetainsHtml" : "false", "actions" : [ }, "action" : "rerender" }, "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); }, { { }, "truncateBody" : "true", "action" : "rerender" "revokeMode" : "true", { "event" : "editProductMessage", ] "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, { { watching = true; Demzufolge werden an den Terminen im April 2021 (wir berichteten) wie bereits im Forum spekuliert zahlreiche Pay-TV-Sender abgeschaltet. "action" : "rerender" ] ] "action" : "rerender" "useCountToKudo" : "false", "action" : "rerender" ] Unitymedia stellt Internet, Telefon und TV über ein Kabel bereit. lithadmin: [] }, Unsere besten Angebote für Dich: Surf mit GigaBit. lithstudio: [], { ] "event" : "RevokeSolutionAction", ] }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/123456/thread-id/157062","ajaxErrorEventName":"LITHIUM:ajaxError","token":"B5jAUKon6T9kts24tb359C3_VpLbtiIBSTeq71ipNuY. "context" : "", "context" : "envParam:quiltName", { "action" : "rerender" { { "context" : "envParam:entity", } } } "event" : "expandMessage", }, ] ] "event" : "MessagesWidgetCommentForm", "actions" : [ } else { "event" : "editProductMessage", // enable redirect to login page when "logmein" is typed into the void =) "triggerSelector" : ".lia-panel-dialog-trigger-event-click", { LITHIUM.Loader.runJsAttached(); } { // just for convenience, you need a login anyways... "actions" : [ }, "context" : "", ] }, LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "approveMessage", LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "eventActions" : [ ] Kombiniere GigaTV Cable oder Horizon TV Cable mit einem Red Internet & Phone Tarif und Du sparst monatlich 5 Euro. //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); }, { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ } { "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/123456/thread-id/157062","ajaxErrorEventName":"LITHIUM:ajaxError","token":"HfAPdpauCvALFIx3w9bUqyqtposPA518XvAMe0AxjC4. "action" : "addClassName" //$('#community-menu-toggle').removeClass('active') //var height = $(window).scrollTop(); { "actions" : [ "parameters" : { } { } ] }, window.onclick = function(event) { return; "}); "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "ProductAnswerComment", ;(function($) { "event" : "approveMessage", "context" : "envParam:quiltName,message", "event" : "addMessageUserEmailSubscription", From global brands to local stands, eBay connects millions of buyers and sellers around the world, empowering people and creating opportunity for all. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/123456/thread-id/157062","ajaxErrorEventName":"LITHIUM:ajaxError","token":"lCqnoDet0MFirfS8Qe0Bacx17SJSvOLbZjw8lRqCFuk. // Set start to true only if the first key in the sequence is pressed "linkDisabled" : "false" { "actions" : [ "action" : "rerender" } Tipp: Rede nicht von IPv4 sondern von Dualstack. "disallowZeroCount" : "false", "kudosLinksDisabled" : "false", "actions" : [ }); var expireDate = new Date(); { UnityMedia: Ständige Verbindungsabbrüche. "actions" : [ } "componentId" : "kudos.widget.button", "actions" : [ ... Soweit ist er mit Unitymedia zufrieden und würde ungern wechseln, da so ein Wechsel nicht immer reibungslos klappt. "context" : "", var position_x = msg.offset(); "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ }, "closeImageIconURL" : "https://forum.vodafone.de/skins/images/0F94F452D57A978C27D2D3E5195EDB37/responsive_peak/images/button_dialog_close.svg", "actions" : [ }, { { } LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); watching = true; ] LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] count = 0; "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'kmMLSo6x_0_ZeuldvZbu3v9l7dej6h-EJmZ0ml4xkZI. "context" : "", ] expireDate.setDate(expireDate.getDate() + 365*10); "event" : "unapproveMessage", { "action" : "addClassName" ] // console.log(key); { ] { 19,99 €. welche Angebote gibt es aktuell, die man evtl. "context" : "", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "context" : "", "displayStyle" : "horizontal", ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "", "messageViewOptions" : "1111110111111111111110111110100101001101" { "action" : "rerender" "displayStyle" : "horizontal", LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. count = 0; ;(function($) { { $(this).toggleClass("view-btn-open view-btn-close"); Netzwerke und Internet. "context" : "", } } "event" : "AcceptSolutionAction", // Reset the conditions so that someone can do it all again. "context" : "envParam:entity", LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "disableLinks" : "false", "action" : "rerender" Our company consists of talent designers and programmers who have strong experience in OpenCart development "disableLabelLinks" : "false", }); Thunderbird Download On the Download page you will find the latest official version of the Mozilla Thunderbird.. A documentation of the program In the lexicon system of this website you will find help articles, instructions, questions and answers (FAQ), etc. ] "action" : "rerender" } ] $(event.data.selector).removeClass('cssmenu-open'); $(event.data.selector).removeClass('cssmenu-open'); } "action" : "rerender" Bitte wählen Sie Ihre Webmail-Adresse aus. } "event" : "MessagesWidgetAnswerForm", }, "context" : "", "event" : "markAsSpamWithoutRedirect", LITHIUM.AjaxSupport.useTickets = false; "actions" : [ $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); "event" : "MessagesWidgetEditAction", "event" : "unapproveMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); { "context" : "", ] { ], ... Wie seht ihr das, ist da was möglich bzw. "actions" : [ } { Als nächstes fragte ich mich, ob es nicht möglich wäre, sich auf Dual Stack umstellen zu lassen. } } //$('#community-menu-toggle').removeClass('active') resetMenu(); Chris. } resetMenu(); } LITHIUM.Auth.CHECK_SESSION_TOKEN = 'Zbgt_GvZ-ehOK2qrR_WhNvrDcCfdsuQNRcrPonknUVg. "actions" : [ ] "context" : "", { "accessibility" : false, "closeImageIconURL" : "https://forum.vodafone.de/skins/images/0F94F452D57A978C27D2D3E5195EDB37/responsive_peak/images/button_dialog_close.svg", "selector" : "#messageview_0", }, } { { "disableKudosForAnonUser" : "false", "actions" : [ "revokeMode" : "true", ] "componentId" : "kudos.widget.button", "context" : "envParam:entity", "context" : "", ] "kudosLinksDisabled" : "false", "actions" : [ { }, { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/123456/thread-id/157062","ajaxErrorEventName":"LITHIUM:ajaxError","token":"lCqnoDet0MFirfS8Qe0Bacx17SJSvOLbZjw8lRqCFuk. { "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "deleteMessage", }, ] }, ] LITHIUM.Auth.CHECK_SESSION_TOKEN = 'Zbgt_GvZ-ehOK2qrR_WhNvrDcCfdsuQNRcrPonknUVg. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); }, "event" : "MessagesWidgetEditAnswerForm", }, })(LITHIUM.jQuery); "context" : "", }); //$('#lia-body').addClass('lia-window-scroll'); { } { } "action" : "rerender" { }, LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_38c8ede636f9cd', 'disableAutoComplete', '#ajaxfeedback_38c8ede06f5e43_0', 'LITHIUM:ajaxError', {}, 'T5wSu265ixl-yJ3a0N1rgJkUYRW9fAaxZBTZVb1xjXE. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "context" : "", "useSimpleView" : "false", Execute whatever should happen when entering the right sequence }, { "event" : "ProductMessageEdit", Hier geben andere Kunden Antworten und teilen ihre Erfahrungen. "actions" : [ } }, // We're good so far. LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2089845}},{"elementId":"link_11","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2089941}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2090138}},{"elementId":"link_19","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2540286}},{"elementId":"link_20","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2514899}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2535480}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2525170}},{"elementId":"link_23","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2524791}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543567}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543559}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543407}},{"elementId":"link_28","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543403}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543216}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543201}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543158}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543129}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543123}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2543120}}]); } "forceSearchRequestParameterForBlurbBuilder" : "false", }); createStorage("true"); "buttonDialogCloseAlt" : "Schließen", "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" "context" : "", "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#pageInformation","feedbackSelector":".InfoMessage"}); "componentId" : "forums.widget.message-view", { Re: Fristlose Kündigung aufgrund anhaltender Störu... Aktivierungscode - Kundenummer funktioniert nicht. $(document).keydown(function(e) { } "parameters" : { "action" : "rerender" { // Reset the conditions so that someone can do it all again. Zugspitze, Garmisch-Classic & Mount Wank: no other region in Germany offers so many high-alpine experiences as the snow-covered mountains around "actions" : [ { "quiltName" : "ForumMessage", ] "event" : "removeThreadUserEmailSubscription", welche Angebote gibt es aktuell, die man evtl. ] "selector" : "#kudosButtonV2",